![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) |
![]() | Protein Pantothenate kinase PanK [52587] (1 species) has a circularly permuted fold compared to the phosphoribulokinase fold |
![]() | Species Escherichia coli [TaxId:562] [52588] (3 PDB entries) Uniprot P15044 |
![]() | Domain d1sq5c_: 1sq5 C: [105884] complexed with adp, pau |
PDB Entry: 1sq5 (more details), 2.2 Å
SCOPe Domain Sequences for d1sq5c_:
Sequence, based on SEQRES records: (download)
>d1sq5c_ c.37.1.6 (C:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha veevrlrk
>d1sq5c_ c.37.1.6 (C:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} mtpylqfdrnqwaalrmtlsedeiarlkginedlsleevaeiylplsrllnfyissnlrr qavleqflgtnrpyiisiagsvavgksttarvlqallsrwpervelittdgflhpnqvlk erglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvvpdilil eglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaftdpdsy fhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevrlrk
Timeline for d1sq5c_: