Lineage for d1sq5a_ (1sq5 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. Protein Pantothenate kinase PanK [52587] (1 species)
    has a circularly permuted fold compared to the phosphoribulokinase fold
  7. Species Escherichia coli [TaxId:562] [52588] (3 PDB entries)
    Uniprot P15044
  8. Domain d1sq5a_: 1sq5 A: [105882]
    complexed with adp, pau

Details for d1sq5a_

PDB Entry: 1sq5 (more details), 2.2 Å

PDB Description: Crystal Structure of E. coli Pantothenate kinase
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d1sq5a_:

Sequence, based on SEQRES records: (download)

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}
mtpylqfdrnqwaalrdsvpmtlsedeiarlkginedlsleevaeiylplsrllnfyiss
nlrrqavleqflgtngqripyiisiagsvavgksttarvlqallsrwpehrrvelittdg
flhpnqvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdk
tvvqpdilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfr
egaftdpdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanha
veevrlrk

Sequence, based on observed residues (ATOM records): (download)

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}
mtpylqfdrnqwaalrdmlsedeiarlkginedlsleevaeiylplsrllnfyissnlrr
qavleqflgtnqripyiisiagsvavgksttarvlqallsrwpehrrvelittdgflhpn
qvlkerglmkkkgfpesydmhrlvkfvsdlksgvpnvtapvyshliydvipdgdktvvpd
ilileglnvlqsgmdyphdphhvfvsdfvdfsiyvdapedllqtwyinrflkfregaftd
pdsyfhnyakltkeeaiktamtlwkeinwlnlkqnilptrerasliltksanhaveevrl
rk

SCOPe Domain Coordinates for d1sq5a_ are not available.

Timeline for d1sq5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sq5b_, d1sq5c_, d1sq5d_