Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) [110161] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110162] (1 PDB entry) Uniprot Q9DBJ3 343-401 |
Domain d1spka1: 1spk A:8-66 [105877] Other proteins in same PDB: d1spka2, d1spka3 Structural genomics target |
PDB Entry: 1spk (more details)
SCOPe Domain Sequences for d1spka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spka1 b.34.2.1 (A:8-66) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} qkvktifphtagnnktllsfaqgdvltllipeekdgwlygehdttkargwfpssytkll
Timeline for d1spka1: