Lineage for d1spka1 (1spk A:8-66)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392557Protein BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) [110161] (1 species)
  7. 2392558Species Mouse (Mus musculus) [TaxId:10090] [110162] (1 PDB entry)
    Uniprot Q9DBJ3 343-401
  8. 2392559Domain d1spka1: 1spk A:8-66 [105877]
    Other proteins in same PDB: d1spka2, d1spka3
    Structural genomics target

Details for d1spka1

PDB Entry: 1spk (more details)

PDB Description: solution structure of rsgi ruh-010, an sh3 domain from mouse cdna
PDB Compounds: (A:) RIKEN cDNA 1300006M19

SCOPe Domain Sequences for d1spka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spka1 b.34.2.1 (A:8-66) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]}
qkvktifphtagnnktllsfaqgdvltllipeekdgwlygehdttkargwfpssytkll

SCOPe Domain Coordinates for d1spka1:

Click to download the PDB-style file with coordinates for d1spka1.
(The format of our PDB-style files is described here.)

Timeline for d1spka1: