Lineage for d1sp8a2 (1sp8 A:208-431)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 502239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) (S)
  5. 502320Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 502356Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (5 species)
  7. 502357Species Corn (Zea mays) [TaxId:4577] [110879] (1 PDB entry)
  8. 502359Domain d1sp8a2: 1sp8 A:208-431 [105869]

Details for d1sp8a2

PDB Entry: 1sp8 (more details), 2 Å

PDB Description: 4-Hydroxyphenylpyruvate Dioxygenase

SCOP Domain Sequences for d1sp8a2:

Sequence, based on SEQRES records: (download)

>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays)}
gaadyglsrfdhivgnvpelapaaayfagftgfhefaefttedvgtaesglnsmvlanns
envllplnepvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfef
mapptsdyydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfle
iiqrigcmekdekgqeyqkggcggfgkgnfsqlfksiedyeksl

Sequence, based on observed residues (ATOM records): (download)

>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays)}
gaadyglsrfdhivgnvpelapaaayfagftgfhefaefttglnsmvlannsenvllpln
epvhgtkrrsqiqtfldhhggpgvqhmalasddvlrtlremqarsamggfefmapptsdy
ydgvrrragdvlteaqikecqelgvlvdrddqgvllqiftkpvgdrptlfleiiqrigcm
ekdekgqeyqkggcggfgkgnfsqlfksiedyeksl

SCOP Domain Coordinates for d1sp8a2:

Click to download the PDB-style file with coordinates for d1sp8a2.
(The format of our PDB-style files is described here.)

Timeline for d1sp8a2: