![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins) the main characteristic feature of this motif is the packing of its two hemes many members contains one or more complete motifs flanked by incomplete motifs and/or other domains |
![]() | Protein Putative Cytochrome c [110040] (1 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [110041] (1 PDB entry) Uniprot Q8E9W8 # SO4144 |
![]() | Domain d1sp3a_: 1sp3 A: [105866] complexed with hec, scn |
PDB Entry: 1sp3 (more details), 2.2 Å
SCOPe Domain Sequences for d1sp3a_:
Sequence, based on SEQRES records: (download)
>d1sp3a_ a.138.1.3 (A:) Putative Cytochrome c {Shewanella oneidensis [TaxId: 70863]} anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma kldlakiaqnvgapvrdncgschfyggggdavkhgdldssmaypdkatdvhmdsdgnnfq cqnchttekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipff akneptkmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanayma gdkmdsnvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsef dwnlaaklgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtr ldwqalgyqgdpmknkqgpkhk
>d1sp3a_ a.138.1.3 (A:) Putative Cytochrome c {Shewanella oneidensis [TaxId: 70863]} anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma kldlakiaqnvgapvrdncgschfygkhgdldssmaypdkatdvhmdsdgnnfqcqncht tekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipffaknept kmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanaymagdkmds nvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsefdwnlaa klgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtrldwqal gyqgdpmknkqgpkhk
Timeline for d1sp3a_: