Lineage for d1sp3a_ (1sp3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012738Family a.138.1.3: Di-heme elbow motif [48711] (8 protein domains)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2012829Protein Putative Cytochrome c [110040] (1 species)
  7. 2012830Species Shewanella oneidensis [TaxId:70863] [110041] (1 PDB entry)
    Uniprot Q8E9W8 # SO4144
  8. 2012831Domain d1sp3a_: 1sp3 A: [105866]
    complexed with hem, scn

Details for d1sp3a_

PDB Entry: 1sp3 (more details), 2.2 Å

PDB Description: Crystal structure of octaheme cytochrome c from Shewanella oneidensis
PDB Compounds: (A:) cytochrome c, putative

SCOPe Domain Sequences for d1sp3a_:

Sequence, based on SEQRES records: (download)

>d1sp3a_ a.138.1.3 (A:) Putative Cytochrome c {Shewanella oneidensis [TaxId: 70863]}
anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
kldlakiaqnvgapvrdncgschfyggggdavkhgdldssmaypdkatdvhmdsdgnnfq
cqnchttekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipff
akneptkmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanayma
gdkmdsnvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsef
dwnlaaklgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtr
ldwqalgyqgdpmknkqgpkhk

Sequence, based on observed residues (ATOM records): (download)

>d1sp3a_ a.138.1.3 (A:) Putative Cytochrome c {Shewanella oneidensis [TaxId: 70863]}
anphkdvlkgpfttgsevttqcltcheeqatdmmktshwtweleqklpdrtvvrgkknsi
nnfcvaissneprctschagygwkdntfdfkdktkvdclichdttgtyvkdpagagepma
kldlakiaqnvgapvrdncgschfygkhgdldssmaypdkatdvhmdsdgnnfqcqncht
tekhqisgnamgvspggidhigcenchdsaphsnkklnthtatvacqtchipffaknept
kmqwdwstagddkpetvdqygkhtyqkkkgnfvwekmvkpqyawyngtanaymagdkmds
nvvtkltypmgdindakakiypfkvhtgkqiydkklnifitpktygkggywsefdwnlaa
klgmeanptmlekgikysgeydfaatemwwrinhmvspkeqalncndchnkgtrldwqal
gyqgdpmknkqgpkhk

SCOPe Domain Coordinates for d1sp3a_:

Click to download the PDB-style file with coordinates for d1sp3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sp3a_: