Lineage for d1sp0a_ (1sp0 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473212Fold b.146: Ctag/Cox11 (Pfam 04442) [110110] (1 superfamily)
    sandwich; 7 strands in 2 sheets, greek-key; permutation of the immunoglobulin-like fold
  4. 473213Superfamily b.146.1: Ctag/Cox11 (Pfam 04442) [110111] (1 family) (S)
  5. 473214Family b.146.1.1: Ctag/Cox11 (Pfam 04442) [110112] (1 protein)
  6. 473215Protein Cytochrome C oxidase assembly protein CtaG [110113] (1 species)
  7. 473216Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [110114] (2 PDB entries)
  8. 473218Domain d1sp0a_: 1sp0 A: [105865]

Details for d1sp0a_

PDB Entry: 1sp0 (more details)

PDB Description: solution structure of apocox11

SCOP Domain Sequences for d1sp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sp0a_ b.146.1.1 (A:) Cytochrome C oxidase assembly protein CtaG {Rhizobium meliloti (Sinorhizobium meliloti)}
veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg
qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl
sytfyprepsk

SCOP Domain Coordinates for d1sp0a_:

Click to download the PDB-style file with coordinates for d1sp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sp0a_: