Lineage for d1sp0a_ (1sp0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824973Fold b.146: Ctag/Cox11 [110110] (1 superfamily)
    sandwich; 7 strands in 2 sheets, greek-key; permutation of the immunoglobulin-like fold
  4. 2824974Superfamily b.146.1: Ctag/Cox11 [110111] (1 family) (S)
    automatically mapped to Pfam PF04442
  5. 2824975Family b.146.1.1: Ctag/Cox11 [110112] (1 protein)
    Pfam PF04442
  6. 2824976Protein Cytochrome C oxidase assembly protein CtaG [110113] (1 species)
  7. 2824977Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [110114] (2 PDB entries)
    Uniprot Q92RG6
  8. 2824978Domain d1sp0a_: 1sp0 A: [105865]

Details for d1sp0a_

PDB Entry: 1sp0 (more details)

PDB Description: solution structure of apocox11
PDB Compounds: (A:) Cytochrome C oxidase assembly protein ctaG

SCOPe Domain Sequences for d1sp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sp0a_ b.146.1.1 (A:) Cytochrome C oxidase assembly protein CtaG {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg
qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl
sytfyprepsk

SCOPe Domain Coordinates for d1sp0a_:

Click to download the PDB-style file with coordinates for d1sp0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sp0a_: