SCOP 1.75: Domain d1soua_: 1sou A:

Lineage for d1soua_ (1sou A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (8 families)

5. Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
   Pfam PF01812; 5-FTHF cyclo-ligase

6. Protein Hypothetical protein aq_1731 [110521] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [110522] (1 PDB entry)
   Uniprot O67621

8. Domain d1soua_: 1sou A: [105858]
   Structural genomics target

Details for d1soua_

PDB Entry: 1sou

PDB Description: nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46

PDB Compounds: (A:) 5,10-methenyltetrahydrofolate synthetase

SCOP Domain Sequences for d1soua_:

Sequence; same for both SEQRES and ATOM records:

>d1soua_ c.124.1.6 (A:) Hypothetical protein aq_1731 {Aquifex aeolicus [TaxId: 63363]}
mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltpl
fpevlkekelilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgv
afdlegyrlgfgkgyydrllkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrr
lrdgrslehhhhhh

Timeline for d1soua_:

• d1soua_ first appeared in SCOP 1.69
  
• d1soua_ appears in SCOP 1.73
  
• d1soua_ appears in SCOPe 2.01
  
• d1soua_ appears in the current release, SCOPe 2.08, called d1soua1