Lineage for d1soua_ (1sou A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595310Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 595311Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 595442Family c.124.1.6: Methenyltetrahydrofolate synthetase [110520] (3 proteins)
    Pfam 01812; 5-FTHF cyclo-ligase
  6. 595450Protein Hypothetical protein aq_1731 [110521] (1 species)
  7. 595451Species Aquifex aeolicus [TaxId:63363] [110522] (1 PDB entry)
  8. 595452Domain d1soua_: 1sou A: [105858]
    Structural genomics target

Details for d1soua_

PDB Entry: 1sou (more details)

PDB Description: nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46

SCOP Domain Sequences for d1soua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soua_ c.124.1.6 (A:) Hypothetical protein aq_1731 {Aquifex aeolicus}
mlkselrkkvlhkrinlseeerrrlsekvisnlkslpefkkskkvalycpikgevdltpl
fpevlkekelilpkvegneislyrvhspaclgvgafgimepvegervnpedvdfiavpgv
afdlegyrlgfgkgyydrllkrvkglkvgvaysfqvferlprdawdipvdvlvteknvrr
lrdgrslehhhhhh

SCOP Domain Coordinates for d1soua_:

Click to download the PDB-style file with coordinates for d1soua_.
(The format of our PDB-style files is described here.)

Timeline for d1soua_: