SCOP 1.69: Domain d1sotb1: 1sot B:255-353

Lineage for d1sotb1 (1sot B:255-353)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (3 proteins)

6. Protein Stress sensor protease DegS, C-terminal domain [110188] (1 species)

7. Species Escherichia coli [TaxId:562] [110189] (3 PDB entries)

8. Domain d1sotb1: 1sot B:255-353 [105854]
   Other proteins in same PDB: d1sota2, d1sotb2, d1sotc2

Details for d1sotb1

PDB Entry: 1sot, 2.3 Å

PDB Description: Crystal Structure of the DegS stress sensor

SCOP Domain Sequences for d1sotb1:

Sequence, based on SEQRES records:

>d1sotb1 b.36.1.4 (B:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli}
irgyigiggreiaplhaqgggidqlqgivvnevspdgpaanagiqvndliisvdnkpais
aletmdqvaeirpgsvipvvvmrddkqltlqvtiqeypa

Sequence, based on observed residues (ATOM records):

>d1sotb1 b.36.1.4 (B:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli}
irgyigiggrqgivvnevspdgpaanagiqvndliisvdnkpaisaletmdqvaeirpgs
vipvvvmqltlqvtiqeypa

Timeline for d1sotb1:

• d1sotb1 is new in SCOP 1.69
  
• d1sotb1 appears in SCOP 1.71
  
• d1sotb1 appears in the current release, SCOPe 2.08