Lineage for d1soqd_ (1soq D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378753Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2378754Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2378755Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2378776Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
    Uniprot P02766 31-143
  8. 2379337Domain d1soqd_: 1soq D: [105851]
    mutant

Details for d1soqd_

PDB Entry: 1soq (more details), 2.1 Å

PDB Description: crystal structure of the transthyretin mutant a108y/l110e solved in space group c2
PDB Compounds: (D:) Transthyretin

SCOPe Domain Sequences for d1soqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soqd_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn

SCOPe Domain Coordinates for d1soqd_:

Click to download the PDB-style file with coordinates for d1soqd_.
(The format of our PDB-style files is described here.)

Timeline for d1soqd_: