Lineage for d1soqc_ (1soq C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457207Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 457208Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 457209Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 457230Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)
  8. 457311Domain d1soqc_: 1soq C: [105850]

Details for d1soqc_

PDB Entry: 1soq (more details), 2.1 Å

PDB Description: crystal structure of the transthyretin mutant a108y/l110e solved in space group c2

SCOP Domain Sequences for d1soqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soqc_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtnp

SCOP Domain Coordinates for d1soqc_:

Click to download the PDB-style file with coordinates for d1soqc_.
(The format of our PDB-style files is described here.)

Timeline for d1soqc_: