SCOP 1.73: Domain d1sokb_: 1sok B:

Lineage for d1sokb_ (1sok B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)

8. Domain d1sokb_: 1sok B: [105847]
   mutant

Details for d1sokb_

PDB Entry: 1sok, 1.6 Å

PDB Description: crystal structure of the transthyretin mutant a108y/l110e solved in space group p21212

PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d1sokb_:

Sequence; same for both SEQRES and ATOM records:

>d1sokb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn

Timeline for d1sokb_:

• d1sokb_ first appeared in SCOP 1.69
  
• d1sokb_ appears in SCOP 1.71
  
• d1sokb_ appears in SCOP 1.75
  
• d1sokb_ appears in the current release, SCOPe 2.08