SCOPe 2.08: Domain d1sokb_: 1sok B:

Lineage for d1sokb_ (1sok B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d1sokb_: 1sok B: [105847]
   mutant

Details for d1sokb_

PDB Entry: 1sok, 1.6 Å

PDB Description: crystal structure of the transthyretin mutant a108y/l110e solved in space group p21212

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d1sokb_:

Sequence; same for both SEQRES and ATOM records:

>d1sokb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiyaelspysysttavvtn

Timeline for d1sokb_:

• d1sokb_ first appeared in SCOP 1.69
  
• d1sokb_ appears in SCOPe 2.07