SCOPe 2.07: Domain d1so9a_: 1so9 A:

Lineage for d1so9a_ (1so9 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.146: Ctag/Cox11 [110110] (1 superfamily)
   sandwich; 7 strands in 2 sheets, greek-key; permutation of the immunoglobulin-like fold

4. Superfamily b.146.1: Ctag/Cox11 [110111] (1 family)
   automatically mapped to Pfam PF04442

5. Family b.146.1.1: Ctag/Cox11 [110112] (1 protein)
   Pfam PF04442

6. Protein Cytochrome C oxidase assembly protein CtaG [110113] (1 species)

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [110114] (2 PDB entries)
   Uniprot Q92RG6

8. Domain d1so9a_: 1so9 A: [105842]

Details for d1so9a_

PDB Entry: 1so9

PDB Description: solution structure of apocox11, 30 structures

PDB Compounds: (A:) Cytochrome C oxidase assembly protein ctaG

SCOPe Domain Sequences for d1so9a_:

Sequence; same for both SEQRES and ATOM records:

>d1so9a_ b.146.1.1 (A:) Cytochrome C oxidase assembly protein CtaG {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg
qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl
sytfyprepsk

Timeline for d1so9a_:

• d1so9a_ first appeared in SCOP 1.69
  
• d1so9a_ appears in SCOPe 2.06
  
• d1so9a_ appears in the current release, SCOPe 2.08