Class b: All beta proteins [48724] (177 folds) |
Fold b.146: Ctag/Cox11 [110110] (1 superfamily) sandwich; 7 strands in 2 sheets, greek-key; permutation of the immunoglobulin-like fold |
Superfamily b.146.1: Ctag/Cox11 [110111] (1 family) automatically mapped to Pfam PF04442 |
Family b.146.1.1: Ctag/Cox11 [110112] (1 protein) Pfam PF04442 |
Protein Cytochrome C oxidase assembly protein CtaG [110113] (1 species) |
Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [110114] (2 PDB entries) Uniprot Q92RG6 |
Domain d1so9a_: 1so9 A: [105842] |
PDB Entry: 1so9 (more details)
SCOPe Domain Sequences for d1so9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1so9a_ b.146.1.1 (A:) Cytochrome C oxidase assembly protein CtaG {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]} veqasdlildekikvtfdanvaaglpwefvpvqrdidvrigetvqimyraknlastpttg qatfnvtpmaagayfnkvqcfcftettlepgeemempvvffvdpeivkpvetqgiktltl sytfyprepsk
Timeline for d1so9a_: