Lineage for d1so4b_ (1so4 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570465Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 570466Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 570467Species Escherichia coli [TaxId:562] [75051] (10 PDB entries)
  8. 570473Domain d1so4b_: 1so4 B: [105837]
    complexed with mg, tx4; mutant

Details for d1so4b_

PDB Entry: 1so4 (more details), 1.7 Å

PDB Description: crystal structure of k64a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate

SCOP Domain Sequences for d1so4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so4b_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
daaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

SCOP Domain Coordinates for d1so4b_:

Click to download the PDB-style file with coordinates for d1so4b_.
(The format of our PDB-style files is described here.)

Timeline for d1so4b_: