SCOP 1.69: Domain d1so4b_: 1so4 B:

Lineage for d1so4b_ (1so4 B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.3: Decarboxylase [51375] (2 proteins)

6. Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)

7. Species Escherichia coli [TaxId:562] [75051] (10 PDB entries)

8. Domain d1so4b_: 1so4 B: [105837]

Details for d1so4b_

PDB Entry: 1so4, 1.7 Å

PDB Description: crystal structure of k64a mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate

SCOP Domain Sequences for d1so4b_:

Sequence; same for both SEQRES and ATOM records:

>d1so4b_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla
daaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq
aqqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk
gipihvfiagrsirdaaspveaarqfkrsiaelwg

Timeline for d1so4b_:

• d1so4b_ is new in SCOP 1.69
  
• d1so4b_ appears in SCOP 1.71
  
• d1so4b_ appears in the current release, SCOPe 2.08