Lineage for d1so4a_ (1so4 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473421Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 473466Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 473467Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (1 species)
  7. 473468Species Escherichia coli [TaxId:562] [75051] (10 PDB entries)
  8. 473473Domain d1so4a_: 1so4 A: [105836]

Details for d1so4a_

PDB Entry: 1so4 (more details), 1.7 Å

PDB Description: Crystal structure of K64A mutant of 3-keto-L-gulonate 6-phosphate decarboxylase with bound L-threonohydroxamate 4-phosphate

SCOP Domain Sequences for d1so4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so4a_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
aaiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

SCOP Domain Coordinates for d1so4a_:

Click to download the PDB-style file with coordinates for d1so4a_.
(The format of our PDB-style files is described here.)

Timeline for d1so4a_: