![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [75051] (14 PDB entries) Uniprot P39304 |
![]() | Domain d1so3b_: 1so3 B: [105835] complexed with mg, tx4; mutant |
PDB Entry: 1so3 (more details), 1.9 Å
SCOPe Domain Sequences for d1so3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1so3b_ c.1.2.3 (B:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} slpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivla dakiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweq aqqwrdagigqvvyarsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfk gipihvfiagrsirdaaspveaarqfkrsiaelwg
Timeline for d1so3b_: