Lineage for d1snya1 (1sny A:2-248)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841706Protein Carbonyl reductase sniffer [110413] (2 species)
  7. 2841707Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110414] (1 PDB entry)
    Uniprot Q9W3H4 # cg10964-pa
  8. 2841708Domain d1snya1: 1sny A:2-248 [105833]
    Other proteins in same PDB: d1snya2
    complexed with nap

Details for d1snya1

PDB Entry: 1sny (more details), 1.75 Å

PDB Description: Carbonyl reductase Sniffer of D. melanogaster
PDB Compounds: (A:) sniffer CG10964-PA

SCOPe Domain Sequences for d1snya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snya1 c.2.1.2 (A:2-248) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mnsilitgcnrglglglvkallnlpqppqhlfttcrnreqakeledlaknhsnihileid
lrnfdaydklvadiegvtkdqglnvlfnnagiapksaritavrsqelldtlqtntvvpim
lakaclpllkkaakanesqpmgvgraaiinmssilgsiqgntdggmyayrtsksalnaat
kslsvdlypqrimcvslhpgwvktdmggssapldvptstgqivqtisklgekqnggfvny
dgtplaw

SCOPe Domain Coordinates for d1snya1:

Click to download the PDB-style file with coordinates for d1snya1.
(The format of our PDB-style files is described here.)

Timeline for d1snya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1snya2