![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein Carbonyl reductase sniffer [110413] (2 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110414] (1 PDB entry) Uniprot Q9W3H4 # cg10964-pa |
![]() | Domain d1snya1: 1sny A:2-248 [105833] Other proteins in same PDB: d1snya2 complexed with nap |
PDB Entry: 1sny (more details), 1.75 Å
SCOPe Domain Sequences for d1snya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1snya1 c.2.1.2 (A:2-248) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mnsilitgcnrglglglvkallnlpqppqhlfttcrnreqakeledlaknhsnihileid lrnfdaydklvadiegvtkdqglnvlfnnagiapksaritavrsqelldtlqtntvvpim lakaclpllkkaakanesqpmgvgraaiinmssilgsiqgntdggmyayrtsksalnaat kslsvdlypqrimcvslhpgwvktdmggssapldvptstgqivqtisklgekqnggfvny dgtplaw
Timeline for d1snya1: