Lineage for d1snub_ (1snu B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735465Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 735466Species Human (Homo sapiens) [TaxId:9606] [111195] (3 PDB entries)
  8. 735470Domain d1snub_: 1snu B: [105830]
    complexed with sto

Details for d1snub_

PDB Entry: 1snu (more details), 2.5 Å

PDB Description: crystal structure of the unphosphorylated interleukin-2 tyrosine kinase catalytic domain
PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOP Domain Sequences for d1snub_:

Sequence, based on SEQRES records: (download)

>d1snub_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsryss
ksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwke
rpedrpafsrllrqlaeiae

Sequence, based on observed residues (ATOM records): (download)

>d1snub_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegk
ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia
e

SCOP Domain Coordinates for d1snub_:

Click to download the PDB-style file with coordinates for d1snub_.
(The format of our PDB-style files is described here.)

Timeline for d1snub_: