Lineage for d1snrc1 (1snr C:5-166)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553929Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 554017Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 554055Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (23 PDB entries)
  8. 554060Domain d1snrc1: 1snr C:5-166 [105827]

Details for d1snrc1

PDB Entry: 1snr (more details), 1.31 Å

PDB Description: Nitric oxide bound to Cu nitrite reductase

SCOP Domain Sequences for d1snrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snrc1 b.6.1.3 (C:5-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6}
taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOP Domain Coordinates for d1snrc1:

Click to download the PDB-style file with coordinates for d1snrc1.
(The format of our PDB-style files is described here.)

Timeline for d1snrc1: