Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
Domain d1snrc1: 1snr C:5-166 [105827] Other proteins in same PDB: d1snra2, d1snrb2, d1snrc2 complexed with act, cu, cu1, no, trs |
PDB Entry: 1snr (more details), 1.31 Å
SCOPe Domain Sequences for d1snrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1snrc1 b.6.1.3 (C:5-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf katkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d1snrc1:
View in 3D Domains from other chains: (mouse over for more information) d1snra1, d1snra2, d1snrb1, d1snrb2 |