Lineage for d1snnb_ (1snn B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609880Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 609881Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 609894Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 609895Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 609896Species Archaeon Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries)
  8. 609898Domain d1snnb_: 1snn B: [105822]
    complexed with ca, r5p, zn; mutant

Details for d1snnb_

PDB Entry: 1snn (more details), 1.55 Å

PDB Description: 3,4-dihydroxy-2-butanone 4-phosphate synthase from methanococcus jannaschii

SCOP Domain Sequences for d1snnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snnb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii}
nvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpdi
cnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraft
ikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpitt
icemmgddgnamsknetkryaekhnliylsgeeiinyyl

SCOP Domain Coordinates for d1snnb_:

Click to download the PDB-style file with coordinates for d1snnb_.
(The format of our PDB-style files is described here.)

Timeline for d1snnb_: