Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
Superfamily d.115.1: YrdC/RibB [55821] (2 families) |
Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein) contains one additional helix in the C-terminal extension |
Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species) |
Species Archaeon Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries) |
Domain d1snnb_: 1snn B: [105822] complexed with ca, r5p, zn; mutant |
PDB Entry: 1snn (more details), 1.55 Å
SCOP Domain Sequences for d1snnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1snnb_ d.115.1.2 (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii} nvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpdi cnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraft ikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpitt icemmgddgnamsknetkryaekhnliylsgeeiinyyl
Timeline for d1snnb_: