Lineage for d1snna_ (1snn A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732157Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 732158Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 732171Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 732172Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 732173Species Archaeon Methanocaldococcus jannaschii [TaxId:2190] [103219] (3 PDB entries)
  8. 732174Domain d1snna_: 1snn A: [105821]

Details for d1snna_

PDB Entry: 1snn (more details), 1.55 Å

PDB Description: 3,4-dihydroxy-2-butanone 4-phosphate synthase from methanococcus jannaschii
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1snna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snna_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]}
nnvekaiealkkgeiilvydsderegetdmvvasqfitpehirimrkdagglictalhpd
icnklgipfmvdilefasqkfkvlrelypndipydekssfsitinhrktftgitdndraf
tikklaelvkegrfndfgkefrspgsvtllraaeglvknrqghtemtvalaelanlvpit
ticemmgddgnamsknetkryaekhnliylsgeeiinyy

SCOP Domain Coordinates for d1snna_:

Click to download the PDB-style file with coordinates for d1snna_.
(The format of our PDB-style files is described here.)

Timeline for d1snna_: