Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
Protein Nucleobindin 1 (CALNUC) [109825] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109826] (1 PDB entry) Uniprot Q02818 228-326 |
Domain d1snla_: 1snl A: [105820] |
PDB Entry: 1snl (more details)
SCOPe Domain Sequences for d1snla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} lkevweeldgldpnrfnpktffilhdinsdgvldeqelealftkelekvydpkneeddmr emeeerlrmrehvmknvdtnqdrlvtleeflastqrkef
Timeline for d1snla_: