Lineage for d1snla_ (1snl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711427Protein Nucleobindin 1 (CALNUC) [109825] (1 species)
  7. 2711428Species Human (Homo sapiens) [TaxId:9606] [109826] (1 PDB entry)
    Uniprot Q02818 228-326
  8. 2711429Domain d1snla_: 1snl A: [105820]

Details for d1snla_

PDB Entry: 1snl (more details)

PDB Description: nmr solution structure of the calcium-binding domain of nucleobindin (calnuc)
PDB Compounds: (A:) Nucleobindin 1

SCOPe Domain Sequences for d1snla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}
lkevweeldgldpnrfnpktffilhdinsdgvldeqelealftkelekvydpkneeddmr
emeeerlrmrehvmknvdtnqdrlvtleeflastqrkef

SCOPe Domain Coordinates for d1snla_:

Click to download the PDB-style file with coordinates for d1snla_.
(The format of our PDB-style files is described here.)

Timeline for d1snla_: