SCOPe 2.01: Domain d1snka_: 1snk A:

Lineage for d1snka_ (1snk A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (31 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d1snka_: 1snk A: [105819]
   complexed with mye, so4

Details for d1snka_

PDB Entry: 1snk, 2.4 Å

PDB Description: cathepsin k complexed with carbamate derivatized norleucine aldehyde

PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d1snka_:

Sequence; same for both SEQRES and ATOM records:

>d1snka_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
pdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsend
gcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekal
kravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiik
nswgenwgnkgyilmarnknnacgianlasfpkm

Timeline for d1snka_:

• d1snka_ first appeared in SCOP 1.69
  
• d1snka_ appears in SCOP 1.75
  
• d1snka_ appears in SCOPe 2.02
  
• d1snka_ appears in the current release, SCOPe 2.08