Lineage for d1snka_ (1snk A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498098Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 498099Superfamily d.3.1: Cysteine proteinases [54001] (11 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 498100Family d.3.1.1: Papain-like [54002] (23 proteins)
  6. 498126Protein (Pro)cathepsin K [54028] (1 species)
  7. 498127Species Human (Homo sapiens) [TaxId:9606] [54029] (17 PDB entries)
  8. 498134Domain d1snka_: 1snk A: [105819]

Details for d1snka_

PDB Entry: 1snk (more details), 2.4 Å

PDB Description: cathepsin k complexed with carbamate derivatized norleucine aldehyde

SCOP Domain Sequences for d1snka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1snka_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens)}
pdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsend
gcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekal
kravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiik
nswgenwgnkgyilmarnknnacgianlasfpkm

SCOP Domain Coordinates for d1snka_:

Click to download the PDB-style file with coordinates for d1snka_.
(The format of our PDB-style files is described here.)

Timeline for d1snka_: