Lineage for d1sn8a_ (1sn8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399747Protein S1-domain of Ribonuclease E [110198] (1 species)
  7. 2399748Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
    Uniprot P21513 35-125
  8. 2399751Domain d1sn8a_: 1sn8 A: [105807]
    complexed with pb

Details for d1sn8a_

PDB Entry: 1sn8 (more details), 2 Å

PDB Description: Crystal structure of the S1 domain of RNase E from E. coli (Pb derivative)
PDB Compounds: (A:) Ribonuclease E

SCOPe Domain Sequences for d1sn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn8a_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]}
aniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvlregq
evivqidkeergnkgaalttfislags

SCOPe Domain Coordinates for d1sn8a_:

Click to download the PDB-style file with coordinates for d1sn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sn8a_: