| Class b: All beta proteins [48724] (177 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
| Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
| Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries) Uniprot Q9PTT3 |
| Domain d1sn5d_: 1sn5 D: [105805] complexed with so4, t3 |
PDB Entry: 1sn5 (more details), 1.9 Å
SCOPe Domain Sequences for d1sn5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sn5d_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs
Timeline for d1sn5d_: