Lineage for d1sn5c_ (1sn5 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries)
    Uniprot Q9PTT3
  8. Domain d1sn5c_: 1sn5 C: [105804]
    complexed with so4, t3

Details for d1sn5c_

PDB Entry: 1sn5 (more details), 1.9 Å

PDB Description: Crystal Structure of Sea Bream Transthyretin in complex with Triiodothyronine at 1.90A Resolution
PDB Compounds: (C:) Transthyretin

SCOPe Domain Sequences for d1sn5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn5c_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
plmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvyr
vefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv

SCOPe Domain Coordinates for d1sn5c_ are not available.

Timeline for d1sn5c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sn5a_, d1sn5b_, d1sn5d_