![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
![]() | Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
![]() | Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
![]() | Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries) Uniprot Q9PTT3 |
![]() | Domain d1sn2d_: 1sn2 D: [105801] complexed with so4 |
PDB Entry: 1sn2 (more details), 1.75 Å
SCOPe Domain Sequences for d1sn2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sn2d_ b.3.4.1 (D:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]} cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs
Timeline for d1sn2d_: