Lineage for d1sn2c_ (1sn2 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2041793Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2041794Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2041795Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2041799Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries)
    Uniprot Q9PTT3
  8. 2041806Domain d1sn2c_: 1sn2 C: [105800]
    complexed with so4

Details for d1sn2c_

PDB Entry: 1sn2 (more details), 1.75 Å

PDB Description: Crystal Structure of Sea Bream Transthyretin at 1.90A Resolution
PDB Compounds: (C:) Transthyretin

SCOPe Domain Sequences for d1sn2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn2c_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
plmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvyr
vefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssv

SCOPe Domain Coordinates for d1sn2c_:

Click to download the PDB-style file with coordinates for d1sn2c_.
(The format of our PDB-style files is described here.)

Timeline for d1sn2c_: