Lineage for d1sn2a_ (1sn2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2768959Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2768963Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries)
    Uniprot Q9PTT3
  8. 2768968Domain d1sn2a_: 1sn2 A: [105798]
    complexed with so4

Details for d1sn2a_

PDB Entry: 1sn2 (more details), 1.75 Å

PDB Description: Crystal Structure of Sea Bream Transthyretin at 1.90A Resolution
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d1sn2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn2a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata) [TaxId: 8175]}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssvhe

SCOPe Domain Coordinates for d1sn2a_:

Click to download the PDB-style file with coordinates for d1sn2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sn2a_: