Lineage for d1sn0a_ (1sn0 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457207Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 457208Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 457209Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 457213Species Gilthead seabream (Sparus aurata) [TaxId:8175] [101559] (4 PDB entries)
  8. 457226Domain d1sn0a_: 1sn0 A: [105794]

Details for d1sn0a_

PDB Entry: 1sn0 (more details), 1.9 Å

PDB Description: Crystal Structure Of Sea Bream Transthyretin in complex with thyroxine At 1.9A Resolution

SCOP Domain Sequences for d1sn0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sn0a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Gilthead seabream (Sparus aurata)}
cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy
rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvssvhe

SCOP Domain Coordinates for d1sn0a_:

Click to download the PDB-style file with coordinates for d1sn0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sn0a_: