Lineage for d1smyp3 (1smy P:74-257)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752715Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1752716Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 1752717Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 1752733Protein Sigma70 [88948] (2 species)
  7. 1752736Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
    Uniprot Q9WX78
  8. 1752738Domain d1smyp3: 1smy P:74-257 [105793]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2
    complexed with g4p, mg, zn

Details for d1smyp3

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (P:) principal sigma factor

SCOPe Domain Sequences for d1smyp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyp3 a.177.1.1 (P:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d1smyp3:

Click to download the PDB-style file with coordinates for d1smyp3.
(The format of our PDB-style files is described here.)

Timeline for d1smyp3: