Lineage for d1smyp1 (1smy P:258-318)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 439355Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 439356Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 439368Protein Sigma70 [88661] (1 species)
  7. 439369Species Thermus thermophilus [TaxId:274] [88662] (2 PDB entries)
  8. 439371Domain d1smyp1: 1smy P:258-318 [105791]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp2, d1smyp3

Details for d1smyp1

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyp1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOP Domain Coordinates for d1smyp1:

Click to download the PDB-style file with coordinates for d1smyp1.
(The format of our PDB-style files is described here.)

Timeline for d1smyp1: