Lineage for d1smyd_ (1smy D:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518828Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 518829Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 518845Family e.29.1.2: RNA-polymerase beta-prime [64490] (2 proteins)
  6. 518852Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 518855Species Thermus thermophilus [TaxId:274] [75610] (2 PDB entries)
  8. 518856Domain d1smyd_: 1smy D: [105779]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyo_, d1smyp1, d1smyp2, d1smyp3

Details for d1smyd_

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp

SCOP Domain Sequences for d1smyd_:

Sequence, based on SEQRES records: (download)

>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekg
qplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarv
eagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvl
adggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleem
khpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdln
dlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplr
sltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkm
eekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlv
egqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakp
srdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlky
vfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliq
ldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekk
qyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnply
vmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgg
adtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradie
aglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvc
qkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvie
lfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyvea
gqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvev
tdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfq
ntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearke
avea

Sequence, based on observed residues (ATOM records): (download)

>d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus}
kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
aieearkeavea

SCOP Domain Coordinates for d1smyd_:

Click to download the PDB-style file with coordinates for d1smyd_.
(The format of our PDB-style files is described here.)

Timeline for d1smyd_: