SCOPe 2.06: Domain d1smxb_: 1smx B:

Lineage for d1smxb_ (1smx B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein S1-domain of Ribonuclease E [110198] (1 species)

7. Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
   Uniprot P21513 35-125

8. Domain d1smxb_: 1smx B: [105773]

Details for d1smxb_

PDB Entry: 1smx, 1.8 Å

PDB Description: Crystal structure of the S1 domain of RNase E from E. coli (native)

PDB Compounds: (B:) Ribonuclease E

SCOPe Domain Sequences for d1smxb_:

Sequence, based on SEQRES records:

>d1smxb_ b.40.4.5 (B:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]}
aniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvlregq
evivqidkeergnkgaalttfislags

Sequence, based on observed residues (ATOM records):

>d1smxb_ b.40.4.5 (B:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]}
aniykgkitriepsleaafvdygaerhgflplkeiareyfparpnikdvlregqevivqi
dkeergnkgaalttfislags

Timeline for d1smxb_:

• d1smxb_ first appeared in SCOP 1.69
  
• d1smxb_ appears in SCOPe 2.05
  
• d1smxb_ appears in SCOPe 2.07
  
• d1smxb_ appears in the current release, SCOPe 2.08