Lineage for d1smxa_ (1smx A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463711Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (20 proteins)
    barrel, closed; n=5, S=8
  6. 463871Protein S1-domain of Ribonuclease E [110198] (1 species)
  7. 463872Species Escherichia coli [TaxId:562] [110199] (3 PDB entries)
  8. 463873Domain d1smxa_: 1smx A: [105772]

Details for d1smxa_

PDB Entry: 1smx (more details), 1.8 Å

PDB Description: Crystal structure of the S1 domain of RNase E from E. coli (native)

SCOP Domain Sequences for d1smxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli}
aniykgkitriepsleaafvdygaerhgflplkeiareyfpanysahgrpnikdvlregq
evivqidkeergnkgaalttfislags

SCOP Domain Coordinates for d1smxa_:

Click to download the PDB-style file with coordinates for d1smxa_.
(The format of our PDB-style files is described here.)

Timeline for d1smxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1smxb_