Lineage for d1smqa_ (1smq A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId:4932] [88795] (2 PDB entries)
    Uniprot P09938
  8. Domain d1smqa_: 1smq A: [105766]

Details for d1smqa_

PDB Entry: 1smq (more details), 3.1 Å

PDB Description: Structure of the Ribonucleotide Reductase Rnr2 Homodimer from Saccharomyces cerevisiae
PDB Compounds: (A:) ribonucleoside-diphosphate reductase small chain 1

SCOPe Domain Sequences for d1smqa_:

Sequence, based on SEQRES records: (download)

>d1smqa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
lmnqyvefvadrllvafgnkkyykvenpfdfmen

Sequence, based on observed residues (ATOM records): (download)

>d1smqa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaase
nlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipei
gekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelic
rdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqy
vefvadrllvafgnkkyykvenpfdfmen

SCOPe Domain Coordinates for d1smqa_ are not available.

Timeline for d1smqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1smqb_, d1smqc_, d1smqd_