Lineage for d1smqa_ (1smq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990178Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1990179Species Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId:4932] [88795] (2 PDB entries)
    Uniprot P09938
  8. 1990181Domain d1smqa_: 1smq A: [105766]

Details for d1smqa_

PDB Entry: 1smq (more details), 3.1 Å

PDB Description: Structure of the Ribonucleotide Reductase Rnr2 Homodimer from Saccharomyces cerevisiae
PDB Compounds: (A:) ribonucleoside-diphosphate reductase small chain 1

SCOPe Domain Sequences for d1smqa_:

Sequence, based on SEQRES records: (download)

>d1smqa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaasd
givnenlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaih
tipeigekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfs
nelicrdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnad
lmnqyvefvadrllvafgnkkyykvenpfdfmen

Sequence, based on observed residues (ATOM records): (download)

>d1smqa_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Baker's yeast (Saccharomyces cerevisiae), Y2 [TaxId: 4932]}
lnkeletlreenrvksdmlkeklskdaenhkaylkshqvhrhklkemekeepllnedker
tvlfpikyheiwqaykraeasfwtaeeidlskdihdwnnrmnenerffisrvlaffaase
nlvenfstevqipeaksfygfqimienihsetysllidtyikdpkeseflfnaihtipei
gekaewalrwiqdadalfgerlvafasiegvffsgsfasifwlkkrgmmpgltfsnelic
rdeglhtdfacllfahlknkpdpaivekivteaveieqryfldalpvallgmnadlmnqy
vefvadrllvafgnkkyykvenpfdfmen

SCOPe Domain Coordinates for d1smqa_:

Click to download the PDB-style file with coordinates for d1smqa_.
(The format of our PDB-style files is described here.)

Timeline for d1smqa_: