Lineage for d1smob_ (1smo B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548284Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)
  7. 548285Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
  8. 548287Domain d1smob_: 1smo B: [105765]
    complexed with tar

Details for d1smob_

PDB Entry: 1smo (more details), 1.47 Å

PDB Description: Crystal Structure of Human Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.47 .

SCOP Domain Sequences for d1smob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smob_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens)}
eekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpvqvgri
iledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtk

SCOP Domain Coordinates for d1smob_:

Click to download the PDB-style file with coordinates for d1smob_.
(The format of our PDB-style files is described here.)

Timeline for d1smob_: