SCOPe 2.08: Domain d1smob_: 1smo B:

Lineage for d1smob_ (1smo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
   Uniprot Q9NP99 21-133

8. Domain d1smob_: 1smo B: [105765]
   complexed with tla

Details for d1smob_

PDB Entry: 1smo, 1.47 Å

PDB Description: Crystal Structure of Human Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.47 .

PDB Compounds: (B:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1smob_:

Sequence; same for both SEQRES and ATOM records:

>d1smob_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]}
eekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpvqvgri
iledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtk

Timeline for d1smob_:

• d1smob_ first appeared in SCOP 1.69
  
• d1smob_ appears in SCOPe 2.07