Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries) Uniprot Q9NP99 21-133 |
Domain d1smob_: 1smo B: [105765] complexed with tla |
PDB Entry: 1smo (more details), 1.47 Å
SCOPe Domain Sequences for d1smob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smob_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} eekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpvqvgri iledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvvtk
Timeline for d1smob_: