Lineage for d1smoa_ (1smo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742085Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)
  7. 2742086Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
    Uniprot Q9NP99 21-133
  8. 2742087Domain d1smoa_: 1smo A: [105764]
    complexed with tla

Details for d1smoa_

PDB Entry: 1smo (more details), 1.47 Å

PDB Description: Crystal Structure of Human Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.47 .
PDB Compounds: (A:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1smoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]}
atklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpv
qvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvv

SCOPe Domain Coordinates for d1smoa_:

Click to download the PDB-style file with coordinates for d1smoa_.
(The format of our PDB-style files is described here.)

Timeline for d1smoa_: