Lineage for d1smib_ (1smi B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542252Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 542253Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 542254Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 542301Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 542302Species Bacillus megaterium [TaxId:1404] [48269] (13 PDB entries)
  8. 542322Domain d1smib_: 1smi B: [105759]
    complexed with hem; mutant

Details for d1smib_

PDB Entry: 1smi (more details), 2 Å

PDB Description: a single mutation of p450 bm3 induces the conformational rearrangement seen upon substrate-binding in wild-type enzyme

SCOP Domain Sequences for d1smib_:

Sequence, based on SEQRES records: (download)

>d1smib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitflieghettsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d1smib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasqsddllthmlngkdp
etgeplddeniryqiitflieghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkiplggi

SCOP Domain Coordinates for d1smib_:

Click to download the PDB-style file with coordinates for d1smib_.
(The format of our PDB-style files is described here.)

Timeline for d1smib_: