Lineage for d1smib_ (1smi B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (69 PDB entries)
    Uniprot P14779
  8. 2005125Domain d1smib_: 1smi B: [105759]
    complexed with hem; mutant

Details for d1smib_

PDB Entry: 1smi (more details), 2 Å

PDB Description: A single mutation of P450 BM3 induces the conformational rearrangement seen upon substrate-binding in wild-type enzyme
PDB Compounds: (B:) bifunctional p-450:nadph-p450 reductase

SCOPe Domain Sequences for d1smib_:

Sequence, based on SEQRES records: (download)

>d1smib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitflieghettsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketltlkpegfvvkakskkiplggi

Sequence, based on observed residues (ATOM records): (download)

>d1smib_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikea
cdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasqsddllthmlngkdp
etgeplddeniryqiitflieghettsgllsfalyflvknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkiplggi

SCOPe Domain Coordinates for d1smib_:

Click to download the PDB-style file with coordinates for d1smib_.
(The format of our PDB-style files is described here.)

Timeline for d1smib_: