Lineage for d1smba_ (1smb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971194Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2971195Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2971196Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2971200Protein Golgi-associated PR-1 protein [111130] (1 species)
  7. 2971201Species Human (Homo sapiens) [TaxId:9606] [111131] (1 PDB entry)
    SQ Q9H4G4
  8. 2971202Domain d1smba_: 1smb A: [105756]

Details for d1smba_

PDB Entry: 1smb (more details), 1.55 Å

PDB Description: Crystal Structure of Golgi-Associated PR-1 protein
PDB Compounds: (A:) 17kD fetal brain protein

SCOPe Domain Sequences for d1smba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smba_ d.111.1.1 (A:) Golgi-associated PR-1 protein {Human (Homo sapiens) [TaxId: 9606]}
saskqfhnevlkahneyrqkhgvpplklcknlnreaqqysealastrilkhspessrgqc
genlawasydqtgkevadrwyseiknynfqqpgftsgtghftamvwkntkkmgvgkasas
dgssfvvaryfpagnvvnegffeenvlpp

SCOPe Domain Coordinates for d1smba_:

Click to download the PDB-style file with coordinates for d1smba_.
(The format of our PDB-style files is described here.)

Timeline for d1smba_: