Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111195] (3 PDB entries) |
Domain d1sm2b_: 1sm2 B: [105755] complexed with sto |
PDB Entry: 1sm2 (more details), 2.3 Å
SCOP Domain Sequences for d1sm2b_:
Sequence, based on SEQRES records: (download)
>d1sm2b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens)} idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac vihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsryss ksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwke rpedrpafsrllrqlaeiae
>d1sm2b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens)} idpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshpk lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac vihrdlaarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegk ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia e
Timeline for d1sm2b_: